McDonnell Genome Institute

Washington University

CircRNA

chr3|129094985|129121492|-|RAB43|ENST00000393304.5

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9872

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

GAALQDRR

Amino Acids from 5' Exons

LQIWDTAGQERFRTITQSYYRSANGAILAYDITKRSSFLSVPHWIEDVRKYAGSNIVQLLI,CRSGTRPARSGSAPSPRATTAVPMGPSLPTTSPRGAPSCRCLTGLRMGSMRAPTLCSCS,ADLGHGRPGAVPHHHPELLPQCQWGHPCLRHHQEELLPVGASLDGCEEVCGLQHCAAAD

Amino Acids from 3' Exons

AMAGPGPGPGDPDEQYDFLFKLVLVGDASVGKTCVVQRFKTGAFSERQGSTIGVDFTMKTLEIQGKRVK,PWQGRAQARGTRTSSTISCSSWCWWATQAWARRAWCSASRPAPSRSAREAPSASTSPRRWRSRASGS,HGRAGPRPGGPGRAVRFPVQAGAGGRRKRGQDVRGAALQDRRLLGAPGKHHRRRLHHEDAGDPGQAGQ