McDonnell Genome Institute

Washington University

CircRNA

chr3|128622163|128638105|-|RPN1|ENST00000296255.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9761

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

LICATDGR

Amino Acids from 5' Exons

DPAAEARMKVACITEQVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTEGSDLCDR,IQPQKPGRPASQSRSPWSTREAFTVTLTRPSIGTSNPGTSPPSTVARRAWRLNTRPPVRLHCCSPGRQRALICAT,SSRRSQDEGSLHHRAGLDPGQQENRPLPSLRDRQVQAIPGHLHPQQWQEEPGDTQGLDQDCTAAVQAEDRGLSVRQ

Amino Acids from 3' Exons

WEILHSQAPSCSSWGQDFSHCGNSLHPCASSVSNPDHPVRETVCGVGEPLFLLSLSNEDTNHACEACLSKCGELHQAGEPHALGPTGLWAFQRCACLS,GRFFTVKLPVALDPGAKISVIVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASRNVESYTKLGNPTRSEDLLDYGPFRDVPAYSQ,GDSSQSSSQLLLILGPRFQSLWKQSTPMCFIRIQPRSPSQRNSLWCLRGTIISTLPIQRRHKPCVSLPLEMWRATPSWGTPRALRTYWIMGLSEMCLPIV