McDonnell Genome Institute

Washington University

CircRNA

chr3|12807305|12817876|+|CAND2|ENST00000456430.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9832

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

4

Peptide

QLAAAWVLWWSK

Amino Acids from 5' Exons

PGSSGGQSEGVPGGDHCGHPVHQHAVRQGAAARHCRHWPQDRPLGAPSCSH,LGPLVVKVKEYQVETIVDTLCTNMRSDKEQLRDIAGIGLKTVLSELPPAAT,WVLWWSKRSTRWRPLWTPCAPTCGQTRSSCETLPALASRPSSRSSLLQPQ

Amino Acids from 3' Exons

ASSSRWPTAPAPPPSGWMPWPSCRGCWAPNQLRPSTHTCLSSCHLWPVWLTLSTRLQPRPWWCCRSWCGPCGRCTGLGCWILSHMLERCLLSPWRDFVPLTWTRRRSGPFPAWATLATWVTGLGMTWSPRYCSSWTACGMRSPGCPPSRRLRWWPYPHYSLTYSPSWPRHCTFWPHSCGRTSGLCDWPHWQPWTPWPRARASASHRLPCRPCWLSCLPWSTRATCMWPSWLWTSLPQPRPSQPLWWRSVALCSQSCCGCCVRPCCQPGFWQLLKASCRPWGPVPRVWTMPNSSACSLRLFMSRLWMVGLACTSRCSTHWPGVWQPSQLPVPKRRQAQPVAWSAMPGRPTPARGSRSWHSCRWLRWVRWLGQATSGSRRCSWKLWGHPVRMGLQPRMHWAVWVLAACPTSCPSCWSRSRLSPDDSTCCCTHSGRPWGPPSLTASPTPRTSGPCCSSAARVLRRAPGGWWPSALGSWSLTLRSFCPACGSSLLQ,HHLLAGRPLQLLHHPDGCPGLLAGAAGHRTSGLPPTLAYPPATCDGLCGLFLQDCSRGPGGAAGAGAGPVAAAQASDAGSAICWRDVCCHPGATSCHPGPGGEGAGHFLHGPPCRPPGPAWGPGAHVTAPPGPPAEDHPAARHQGAYAGGRIPTTAPTAHPGRGTAHSGLIPAEEPAGFATGHTGSPGRPGPEPGPQPPTVCRAGRAGAACPGQRERHACGPAGCGLPCHSDPGPASLFGGGQWPCALRAAAAAAFAPVASRGSGSCRLPAGPGRDPSPVCGLCQTHQPAHCACLAGCGWWAWPAQAGVPLIGPVCGSPLSCLSPRGGKHSQSPGLRCQVAPLQHGGQGPGILVAGGGSGGWARPPAGAEGGAPGSFGVTQGCEGCSLVCTGPCGCWQPARLPALPAGADRGAPTTVPAAALTQGGPGGRPAQPEALRRGHLGLAVPALRGCGGHPGGGGRVHWEAGPCEPFVPSAPLAEAACC,IIFSLADRSSSSTIRMDALAFLQGLLGTEPAEAFHPHLPILLPPVMACVADSFYKIAAEALVVLQELVRALWPLHRPRMLDPEPYVGEMSAVTLARLRATDLDQEVKERAISCMGHLVGHLGDRLGDDLEPTLLLLLDRLRNEITRLPAIKALTLVAVSPLQLDLQPILAEALHILASFLRKNQRALRLATLAALDALAQSQGLSLPPSAVQAVLAELPALVNESDMHVAQLAVDFLATVTQAQPASLVEVSGPVLSELLRLLRSPLLPAGVLAAAEGFLQALVGTRPPCVDYAKLISLLTAPVYEQAVDGGPGLHKQVFHSLARCVAALSAACPQEAASTASRLVCDARSPHSSTGVKVLAFLSLAEVGQVAGPGHQRELKAVLLEALGSPSEDVRAAASYALGRVGAGSLPDFLPFLLEQIEAEPRRQYLLLHSLREALGAAQPDSLKPYAEDIWALLFQRCEGAEEGTRGVVAECIGKLVLVNPSFLLPRLRKQLAA