McDonnell Genome Institute

Washington University

CircRNA

chr3|127619026|127619278|+|MCM2|ENST00000265056.11

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9305

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

ESMDEMLAR

Amino Acids from 5' Exons

DEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESM,TRCWPASWWAATSDTTPATRRRRGWPMAALLSPPCPTRMAWSPCPRRSRSTSSTPRRGSTRSSTRWTRTRWPRCTVTGKNL,RDAGPLRGGQPRQTPPQQQGGGGAGQWQRCARHAQHVWRGAPAPGGPEEVHHLRQGEGPPEAQPDGPGQGGQDVQPEERIY

Amino Acids from 3' Exons

DEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESM,TRCWPASWWAATSDTTPATRRRRGWPMAALLSPPCPTRMAWSPCPRRSRSTSSTPRRGSTRSSTRWTRTRWPRCTVTGKNL,RDAGPLRGGQPRQTPPQQQGGGGAGQWQRCARHAQHVWRGAPAPGGPEEVHHLRQGEGPPEAQPDGPGQGGQDVQPEERIY