McDonnell Genome Institute

Washington University

CircRNA

chr3|127016516|127018528|+|PLXNA1|ENST00000393409.2

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9142

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

EGGTPVR

Amino Acids from 5' Exons

EELPDPVPDTPRAEPWQRSHHHQHQPRPAHQPGEVQLHRGPHHPEDRPRVEHQQ,RNSREIRCLTPPGQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSIN,GTPVRSGAHPPGRALAALPSSSTSTAPSSPTLRSTTTPRTPPSGSTPSGAST

Amino Acids from 3' Exons

VRAGGFEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKE,CGQVASSSRQGHCRCTRTACRCLPLWALAEAGVSCCWSSWLCSSPTSASHEMLTAHSSGCSSRWTTWSPAWPSNARK,AGRWLRVLARDTAGVLGQPADAACHCGHWRRRGSPAAGHRGCAHRLQAQVTRCPHTQAAAAPDGQPGVPRGPRMQG