McDonnell Genome Institute

Washington University

CircRNA

chr3|12600151|12604289|-|RAF1|ENST00000251849.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9983

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

AGTSIWDPGEK

Amino Acids from 5' Exons

PHLQPCPVAPTIAQQAGHSRKPPCQHKESGHQYLGPRRKTK,LTFSPVQPQQSEPNRLVTAENPRASTKRAGTSIWDPGEKQN,SPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKI

Amino Acids from 3' Exons

FSAQIFYTSRLHLHLQSLIRFPLPEAEVDIHTCPHGQHHPACGQQDD,SQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIE,LSTDILHLTPSPLTPPVPHLKVPSPRGRGRHPHLMSTWSAPPCLWTAGL