McDonnell Genome Institute

Washington University

CircRNA

chr3|125531860|125552679|-|OSBPL11|ENST00000296220.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.944

18

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

10

Peptide

EVVLPTFILEK

Amino Acids from 5' Exons

AIVEKCDRLAERINGHRAAYPGRTSEDRKASYNRHTLENQIFYR,RLWKNVTDSLRESEIDKATEHKHTLEERQRTEERHRTETGTPWKTKYFIKE,DCGKMQTRENLKLIRPQSISIPWKNVRGLKKGIVLKQAHLGKPNILLK

Amino Acids from 3' Exons

VVLPTFILEKRSLLEMYADFMSHPDLFIAITNGATAEDRMIRFVEYYLTSFHEGRKGAIAKKPYNPIIGETFHCSWKMPKSEVASSVFSSSSTQGVTNHAPLSGESLTQVGSDCYTVRFVAEQVSHHPPVSGFYAECTERKMCVNAHVWTKSKFLGMSIGVTMVGE,WCFLHLSRSVPCWKCMQTLCLIQTYLPSLMEPQLRTEFALLSTTLPHFMKAVREPLLKNHTILSLEKHFTVPGRCQKARHPVFLAVLPPRESQIMLLYRGSLPRWDQTVTQSDLLLSRFLIILQSQDFMQNVQRGRCVMRMSGLRASSACQAQWLEK,GASYIYPREAFLAGNVCRLYVSSRPIYSHHWSHSGQNDSLCVLPYLISRPGSHCKTIQSYHWRNISLFLEDAKKRGSIQCFQFFHPGSHKSCSFIGGVFDPGGIRLLHSQICCAGFSSSSSLRILCRMYREEDVCKCACLDEQVLRHVNRRDNGWR