McDonnell Genome Institute

Washington University

CircRNA

chr3|124821312|124848558|-|ITGB5|ENST00000296181.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.998

15

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

26

12

Peptide

LGGLVQPHDGQCHLNEANEYTASNQMVTRPPSSYRFAR

Amino Acids from 5' Exons

EKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQM,RRLAGERMHCICWCSQQMMCPTSHWMENWEAWCSHTMASATTRPTSTLHPTR,EDWLAKGCTAFAGVHNRCAPHRIGWKIGRPGAATRWPVPPERGQRVHCIQPD

Amino Acids from 3' Exons

VTRPPSSYRFARWRTILWTCTTWTSPCPRMTWTISGAWAPNSRRRGSSPATSGWDLGLLLIRTSLLSPTRHRGTRPIRAL,QDHLPATGSPGGGLSCGPVLPDGPLPVHEGLGQYPEPGHQTRGGDEEAHQQLPVGIWVFCGHLSFLLHGTEVPDQSVHW,DKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCI