McDonnell Genome Institute

Washington University

CircRNA

chr3|124796387|124821474|-|ITGB5|ENST00000296181.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9817

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

ESSAQEK

Amino Acids from 5' Exons

ASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKGVLCS,HLLKYHWRPEAVPADTRSMCLPCGRWDSGTAWRWGSPTTARAAAAWGWNPTAPGATGAGPMSAACVSAAPATWAPGASARMGRTRACTRTCAGRQRASHCAAGVGTAAATSAPASRASLARSMGLSVSATTSPVPGTRESSAQ,IFSIIGGPKLSQQTHGACVCPAAGGIPGQPGGGGHLQLHVRLQRGAGTQQRQVQRERDLCLRPVVQPRLPGHQVRVPGWGEPERVPEPVPGGRGQATVQRAWGLQLQPVLLLRERVWQDLWAFLVRQLLLCQEQGSPLL

Amino Acids from 3' Exons

EKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQM,RRLAGERMHCICWCSQQMMCPTSHWMENWEAWCSHTMASATTRPTSTLHPTR,EDWLAKGCTAFAGVHNRCAPHRIGWKIGRPGAATRWPVPPERGQRVHCIQPD