McDonnell Genome Institute

Washington University

CircRNA

chr3|123209198|123209399|+|PDIA5|ENST00000469649.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9851

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

SSLLVEMSMILSASVIR

Amino Acids from 5' Exons

VFSVGNVYDFICLSHSCQRWTATFCFYLTKHRNAGVQKVFNAFEETCSTSMYTENWTLH,SSLLVEMSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNI,LLCWLKCLFYLPQSFVSEMDCHFLLLLIMNKAQECRSAESILKCFRGNLLNFLIDVHKLDIITL

Amino Acids from 3' Exons

VFSVGNVYDFICLSHSCQRWTATFCFYLTKHRNAGVQKVFNAFEETCSTSMYTENWTLH,SSLLVEMSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNI,LLCWLKCLFYLPQSFVSEMDCHFLLLLIMNKAQECRSAESILKCFRGNLLNFLIDVHKLDIITL