McDonnell Genome Institute

Washington University

CircRNA

chr3|122699389|122720388|+|PARP14|ENST00000474629.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9587

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

1

Peptide

EVLDTIMATK

Amino Acids from 5' Exons

CTPSWPQNSTSIKCHFLCSHTMPHWAQPCMERRSLSSFQHHLKSHIFPYGSSYRKRITSLRRTMKGVVTVSSRGPNSVVKLPSDQQPPSMKEDRESRPGRQILPQHSLASGLNIKSTQLKWIQQCGTPKMMKMTGFLSLIHLRRWSQGNQRMSKALRYKSGSKALLKKLKGKSKVRKKSFLQAGIFFCVTAVYWTIYSRSAQRRFVTIESLNTCAKDLVQMCIKQSVKSRKRCTPWLRKTFRFLLRFFSFCNRTGKNSLSVFSHRRFLHFMSRVQLFSPAVLLKPCKQKSKCSVPIISALKLRTKKFFMARNGKGSLTICLRNKIPPQTLSSMSLQKPQLKSSLQAVKKMKPINCFLTSLNKTKRDWLKSLPLLTIRQKRSYSGQRRRMCRVSILRTNKKAFYLAQRPKYRQWTLSSKSGIQSVLKVSILISQEPSSSSRIKHGFIKVRSNGCLVVTLNYRRMKRREAAPLGRSASLGQSWPLALCLCSRVTWHGFLSMWWMHLMRTLSIMVAWPLRSQKQLALSSRPTVTRRERADSYRAMPPSPRQESCPTTTSMQWGPAGADMRPRGVCTYGELCNSVSVPKNTSTDPPSQLLVLESLAFPADAWRPLFLPSRKTSNSRRMDTAKKSTLWMYLRRLLRPLQKLKLYLKPPCQIQLPRQVYHQQQRGLGKHHGKKEAWCPREACRCCWKRVCRML,VRHHHGHKTRLQNATFCVPILCLIGHSLVWKGEASDQASSTIRVTRSSLMEVLTEKESPHGDKRNEALSLAHVVPTQWSYHQTSSHLSQRKTENQDLAGRYFHNTLHQVISQPNSGSNNVGHHKKCERQDFDVYTGDGNLSREIRGCPKHGTSQGVNRKHYSKNKGRAKFEGKNDHFSRQVFSFVSQQSTGPFTHGVPRDRDLLRSHSTLVLERTCRCVSKVNPGKGVHHGSEKHSGFSDFSVFATGKLERILVSFHSTEDSCTLARGYNCSLNQLFFSPVRSRKANAQCLKLAHSEQRSSSWQEMERAHSQFAETKFLPKHCNHQVNFRNHSSHHYRLCKRSKNLIAFLRTKHENRETGSKAFLSYLFKDRKEAILAKDKEGKCAGKFQSEQTKRHFTNWLKDRSTEGSGHCQASLGFSLCKCPYARSQAVLPGSTVLSKDQTVVWLLHTTGESNEGGRQPRWAEVLLSDSLGPWRCADCAAGLGTASCRCGGECIGPALWWPGRCALKSSWPAPGRLPDSEERGQTPTGQCHHLQGRKAALPPRDPCSGAPLERIGPEVCVPIKESCATQSLSSRKIQVPIHSHPSYFWSLWLSLRPMRGDHCFCHQGKLPIQEGWTLLERNLPCGCIEDCGLCRSCENCISHPARYSCPARFTTSSSGAWENIMGKRKPGVPGRPADAVGERGCAEC,LDTIMATKLDFNKMPLSVFPYYASLGTALYGKEKPLIKLPAPFEESLDLPLWKFLQKKNHLIEEINDEMRRCHCELTWSQLSGKVTIRPAATLVNEGRPRIKTWQADTSTTLSSIRSKYKVNPIKVDPTMWDTIKNDVKDDRILIEFDTLKEMVILAGKSEDVQSIEVQVRELIESTTQKIKREEQSLKEKMIISPGRYFLLCHSSLLDHLLTECPEIEICYDRVTQHLCLKGPSADVYKAKCEIQEKVYTMAQKNIQVSPEIFQFLQQVNWKEFSKCLFIAQKILALYELEGTTVLLTSCSSEALLEAEKQMLSALNYKRIEVENKEVLHGKKWKGLTHNLLKKQNSSPNTVIINELTSETTAEVIITGCVKEVNETYKLLFNFVEQNMKIERLVEVKPSLVIDYLKTEKKLFWPKIKKVNVQVSFNPENKQKGILLTGSKTEVLKAVDIVKQVWDSVCVKSVHTDKPGAKQFFQDKARFYQSEIKRLFGCYIELQENEVMKEGGSPAGQKCFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKAAGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEKYKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEAVKTVFKATLPDTAAPPGLPPAAAGPGKTSWEKGSLVSPGGLQMLLVKEGVQNAK

Amino Acids from 3' Exons

LTSLHTGVISSRISVWWSCCLVILSTTRWQASLIRPAHTSER,HPCTLEYEAAEFLCGGAAASVQHGGKQVSDLLTLQNRE,DIPAHWSDMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEK