McDonnell Genome Institute

Washington University

CircRNA

chr3|121790072|121797227|-|IQCB1|ENST00000310864.10

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9202

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

ELQLSMLEIVHPGLRR

Amino Acids from 5' Exons

IQTIKDVAGDKAEGRRGPQITIATSKTESHETFPRIAAEYARNSSS,SKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHP,PNDQRCCWRIGRRKKRTSNYNCNFKDREPDFPENCSVCSKFIQ

Amino Acids from 3' Exons

DSDVYVNRKLGLNSVKNLDSLLAFAQWSIRKKS,TQTSTKTGNWDIQSRTTACWPFKPNGLSGSRRA,LRRLLSKQETGTEFSQELRQLVGLLSPMVYQEVEEQ