McDonnell Genome Institute

Washington University

CircRNA

chr3|121716736|121729340|-|GOLGB1|ENST00000340645.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9718

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

2

Peptide

NEQAVQSAQTIQQLEGR

Amino Acids from 5' Exons

ILSQQLQQMEAEHNTLRNTVETEREESKILLEKMELEVAERKLSFHNLQEEMHHLLEQFEQAGQAQAELESRYSALEQKHKAEMEEKTSHILSLQKTGQELQSACDALKDQNSKLLQDKNEQAVQSAQTIQQLE,FSLSSYSRWKLSIILGTLWKQKERSPRFYWKRWNLKWQRENYPSIICRKKCIIFNSLSKQAKPRLNSLGIVLWSRSTKQKWKRRPLIFVFKRLDKSCSLPVMLRIKIQSFSKIRMSKQFSQPRPFSNWK,SLSAVTADGSAYFEEHCGNRKRGVQDSTGKDGTSGREKIILPSAGRNASSFRTVASRPSPGTRVSVCFGAEAQSRNGREDLSYFESSKDWTRAAVCLCSKGSKFKASPREASSSVSPDHSATG

Amino Acids from 3' Exons

EERKAADNKIKKLKLHAKAKLTSLNKYIEEMKAQGGTVLPTEPQSEEQLSK,KREKLLITKLKNNFMRRPNLLINTKKKHKEGLFCLQNLSQRSNFP,REKSCQNKTKTSCEGQINFFEIHRRNESTRRDCSAYRTSVRGATFQ