McDonnell Genome Institute

Washington University

CircRNA

chr3|121647318|121657352|-|HCLS1|ENST00000497391.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9168

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

SLGHVVSSSIHQLR

Amino Acids from 5' Exons

DRALVMWFLPASTSGTKYQRSMMFSGRKRWSQGPKHPMAMEVGLEKETEWT,IDEPWSCGFFQHPPAEEQSIRGACSQEERDGVRAQSIPWLWRSVWSRKRPNGQ,MSLGHVVSSSIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDK

Amino Acids from 3' Exons

NDISEKEQRWGAKTIEGSGRTEHI,MTSLKRSNDGEPRPSRGLDAQNTS,HLKGATMGSQDHRGVWTHRTHQ