McDonnell Genome Institute

Washington University

CircRNA

chr3|121519870|121541479|-|POLQ|ENST00000264233.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9566

23

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

6

Peptide

GVDTVAPTSAGK

Amino Acids from 5' Exons

VLLLRRGISLKEPFVKVSFGSWRQLLLFLLGIYLHVVLFEPLFLVVDLIFLLISRWLAVLAGKEWTQ,SYFGEGYHRSLSSRSHSGLGGNFYSFFWGEFTCTSCDYSNPYFWWSTSRYSYLADGWPCWQERSGHS,LTFEERDIIEGAFRQGLIRVLAATSTLSSGVNLPARRVIIRTPIFGGRPLDILTYKQMVGRAGRKGVDTV

Amino Acids from 3' Exons

LLQVLGRLLWQNYLFSGFWKCGRKLCLFFPLFLWLKRRNTTS,SYKCWEDSCGRITYFEAGFGNAEESFVYSSLCFCGREEILPP,PTSAGKTLVAELLILKRVLEMRKKALFILPFVSVAKEKKYYLQ