McDonnell Genome Institute

Washington University

CircRNA

chr3|119582133|119582467|+|ADPRH|ENST00000357003.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9188

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

APDTLSR

Amino Acids from 5' Exons

TPSPEPSNCEGLMEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAP,HPLQSPAIVRDWRSMWLLWCVQLEMPWGTTMGSGSSSRMGRRYTGSWPSWAAWMPTWEGGELVTTQCTWPQQKLLWKLGKPLSLNCITSLLSITKTAWKTWMGGHQ,TLSRAQQLGTDGEVCGCYGAECSWRCPGVLQWEVGVPPGWGEDTPAVGPAGRLGCPRRGKVESRHSDALGHSRSSCGSWESPVDSTVLPPCALPRLHGRHGWAGT

Amino Acids from 3' Exons

TPSPEPSNCEGLMEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMHLATAEALVEAGKAPKLTQLYYLLAKHYQDCMEDMDGRAP,HPLQSPAIVRDWRSMWLLWCVQLEMPWGTTMGSGSSSRMGRRYTGSWPSWAAWMPTWEGGELVTTQCTWPQQKLLWKLGKPLSLNCITSLLSITKTAWKTWMGGHQ,TLSRAQQLGTDGEVCGCYGAECSWRCPGVLQWEVGVPPGWGEDTPAVGPAGRLGCPRRGKVESRHSDALGHSRSSCGSWESPVDSTVLPPCALPRLHGRHGWAGT