McDonnell Genome Institute

Washington University

CircRNA

chr3|11358417|11364734|+|ATG7|ENST00000354449.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9311

28

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

28

14

Peptide

MNEPPTSLGLVPHQNARGFNMSIPMPGHPVNFSSVTLEQARR

Amino Acids from 5' Exons

NARGFNMSIPMPGHPVNFSSVTLEQARRDVEQLEQLIESHDVVFLLMDTRESRWLPAVIAASKRK,MPEDSTAYLCLGIQTSPVSLWSKPAEMWSNWSSSSKAMMSSSYWTPGRAGGFLPSLLQARE,CQRIQHEHTYAWASSELLQCHSGASPQRCGATGAAHRKPCRLPIDGHQGEPVASCRHCCKQEK

Amino Acids from 3' Exons

GLCHCQQQRSDEASNLSWACASP,GYAIASSSDDRMNEPPTSLGLVPHQ,AMPLPAAVTIGMSLQPLLGLCLT