McDonnell Genome Institute

Washington University

CircRNA

chr3|111884063|111954029|+|PHLDB2|ENST00000393923.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

1

Peptide

IMEEHSYIQK

Amino Acids from 5' Exons

IPARLWKSIATYKRSIYKMVARKTLWCILLRTIPKTWRASAQRNTLPVDLKPMETILAPIPSHNLCLQREALLLWEPVSEAAPPPKSREASSSLMMELTKIFLNLQLLYSTLHPPSVDIHLEEQTLIIILAGTVKGPGSQRSLPIPNIAQGINRMTMSTLLEGWKVGRHLARSWPCGMEVPVMLARLLSADREPQACLQAQSKPGKAFRTAWRFNPSLDTRSLHLKTSIELGSTPAAAVTWEPTADHFPGCTEPQRTSHLSACLQETLWAIPNEQNLGKRIYLIATMTITLIFLLAQGLYPIKPLLLKAILMVLPSVSLPVHEWLGRCFWPPPPPVPLMTLIRLHMWGQTRVIHFLLESQTEFLRPGGTSLVDLWNLMRQIWKASDRPQEPPSLPFGNGKAVLAPFQDVMTWIITGGRGRKDSGSRKWSD,FQQDYGRALHTKGARFTKWLRGRLCGAFCERFPKHDGEPQPKEILFQSEISQWRLFWLLFNPLTTCACKEKPFSFGNQCQKQPLLSQNPGKQAVLLWNQKYSYETSNSFTQHYILPQWISTWKSRLSLYWPGQKGLEALREASLFQILKAIAQCLLSWRAGRSEGIWLAPGHVEWKFPECWPASYQQIGSRKHAFKPKASQENEHSGQPGASTQVNTQGACIKHQFENEVLQQQPESHGSLQPITSQVVQSHREPADTSQLASKKLSGQFQTNKTWGKGSTSRNRQQLPFFFFELRGFTLNLCFRQSLCKFYPQCPCQSTSGSEDASGLHLLLCLLSGFICGDKPESFTSCWRVRQSFCDQEELLLWICGIGRFGKPQTGLRNPPACPSGTEKQYLHFRTPDGLSPAAEGGKTQGAGNGAI,SSKIMEEHSYIQKELDLQNGSLEEDSVVHSVENDSQNMMESLSPKKYSSSLRFKANGDYSGSYLTLSQPVPAKRSPSPLGTSVRSSPSLAKIQGSKQFSYDGTDKNIPMKPPTPLLNTTSSLSGYPLGRADFDHYTGRDSERALRLSEKPPYSKYSSRHKSHDNVYSLGGLEGRKASGSLLAMWNGSSLSDAGPPPISRSGAASMPSSPKQARKMSIQDSLALQPKLTRHKELASENINLRTRKYSSSSLSHMGAYSRSLPRLYRATENQLTPLSLPPRNSLGNSKRTKLGEKDLPHSVIDNDNYLNFSSLSSGALPYKTSASEGNPYVSSTLSVPASPRVARKMLLASTSSCASDDFDQASYVGTNPSHSLLAGESDRVFATRRNFSCGSVEFDEADLESLRQASGTPQPALRERKSSISSISGRDDLMDYHRRQREERLREQEMERL

Amino Acids from 3' Exons

AHLPLGQSNSCGSVLPPSLAAMAKDSESRRMLR,PICPDRVTAVEVCSLPHWQPWPKTQNLGGCSE,PSAPRTEQLWKCAPSLTGSHGQRLRISEDAQ