McDonnell Genome Institute

Washington University

CircRNA

chr3|107728764|107728960|+|BBX|ENST00000325805.12

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9855

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

10

Peptide

KCLSLTLEWLYK

Amino Acids from 5' Exons

YKDAFMKANPGYKWCPTTNKPVKSPTPTVNPRKKLWAFPSDSSRDLPSPKKAKTEEMPQLNFGMA,IRMHLKQILATNGVLPQTSLNPQHPLSIHERNFGPSHLTLQETCQAPRKQRLKKCLSLTLEWL,GCIYESKSWLQMVSYHKQACEIPNTHCQSTKETLGLPILFKRLAKPQESKDRNASALWNG

Amino Acids from 3' Exons

YKDAFMKANPGYKWCPTTNKPVKSPTPTVNPRKKLWAFPSDSSRDLPSPKKAKTEEMPQLNFGMA,IRMHLKQILATNGVLPQTSLNPQHPLSIHERNFGPSHLTLQETCQAPRKQRLKKCLSLTLEWL,GCIYESKSWLQMVSYHKQACEIPNTHCQSTKETLGLPILFKRLAKPQESKDRNASALWNG