McDonnell Genome Institute

Washington University

CircRNA

chr3|105776395|105867591|-|CBLB|ENST00000264122.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9728

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

QMLLNSGESFLETK

Amino Acids from 5' Exons

TKSHKTVPYLQSHAGRNQSNLSQWSIPGRLSYHKSRCCILEKVFWRQ,RNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAEFWRKFFGD,EISQNCPLSSVTCWQKSKQSFPMVNSREITFVSQKQMLLNSGESFLET

Amino Acids from 3' Exons

NNSRWQTQMAETLVVEEEIPEKVEFWVLLMLFRMQLDPLSKLPQIAGPWRRLGSSWTK,TKIPDGKLNEWQKPWWSRRKSPKRSNFGYYCYSGCSWTPASCRRSQDRGEDLEAHGQS,LKFQMANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKV