McDonnell Genome Institute

Washington University

CircRNA

chr3|105524288|105533690|+|ALCAM|ENST00000306107.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9736

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

AISHGTGMEK

Amino Acids from 5' Exons

EKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTIVKVF,KSPMAPQYLLPSDPLQRKVCSTTMYQNTKTDTSQKTTLCLSVMQGSVMKRDLCACLRTTCLRHLQSRCS,KARWLPSIYCLQILYKEKCAVRRCTRIQRQIEPLRKLHFVYQCKDQKEICVHASNGQRVGTYNSQGV

Amino Acids from 3' Exons

LGDCISEDSYPDGNITWYRNGKVLHPLEG,WVTAFQKTVIQMAISHGTGMEKCYIPLKE,GLHFRRQLSRWQYHMVQEWKSATSPR