McDonnell Genome Institute

Washington University

CircRNA

chr3|101327665|101368011|-|SENP7|ENST00000314261.11

Cancer

Type of Peptide

BRCA-HER2-enriched

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9502

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

LWSIFIAVCGK

Amino Acids from 5' Exons

VFRGRVGSTKNSSSIQQNKHGGSMPSSTGQQLWSIFIAVCGKLLQ,YLEVEWEVKLKTHRQFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFK,IRSGKLNKLIVNSAKQTWWIYALKFLNRTIAVIVEYIYCSMWKASS

Amino Acids from 3' Exons

TLTVEVEVVIISNRKAETRMLNILIQKWNSLFPGRQREGLEIIYLILNIVLLWISQQNR,PQWKRLSSRTGKQKQGCIFFKSGTHSDFQEDKEKAKFTFSILYFFGVNRTD,LNSGSRGCDHLEQESRNKDVKYSDSKVELTLISRKTKRRLRNNLPDSQYCTSLDKSTEQT