McDonnell Genome Institute

Washington University

CircRNA

chr22|49787389|49824331|-|BRD1|ENST00000404034.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9276

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

LDAGNHYQMRR

Amino Acids from 5' Exons

SFRGWRLFCSQGKGRGAHAETPRWRRSPQESAWTQ,PSEVGDSSAAKEKVAEHMRRLRGGGGVPRKAPGR,LPRLETLLQPRKRSRSTCGDSEVEEESPGKRLDA

Amino Acids from 3' Exons

VIITKGGKDDVIEALQRGILLPHAVLNTPLREKRPTLKLKGWRKLKGACTGSVFLIPWRSYWKMTSLLKRVSATATRKTASGLLSAELSVTKTTESKRKTRPSPAPTARRPRPVPSRSPRCASWSTALRPPPGGLLCTTSSSRSRPRNWTTRWSMTWTRRTMPGWRSSMRSARATASPPCRRACLSSWTASRRSRTARTRSRASSSLSTRTPCAASAWTGSVRTATSSSATCATWPCTRSATGCPTSPRASGSAATACSRGPGPPTVCCAPTRVVPSKRQMTTAGVTWCVPCGSQRSALPTRCSSSPSMGGTSLQPGGNHATSVSRRAWVPASSATKQTATQHSMRVPRRLACTKWSPRNLAVAPPSPSERPLTVMSTRLQAAPGGLIFTGMSKKMASVEKRARLKRSGPHPRSGRRQKRLRKLWLSPARSCRPCALLIFPRR,SLPNEEERTMSSRLCSEASFFPMQCTLPYARNADLRSSSKDGRDRNRALAQDQYFSPGDHIGRPHCSRDEVQQQQGKQRAASCLLKNASQKQQSQKEKRGPPQRPRHAGLGQCPPGAQGAHRGVQPSVRPQEASCVLQVHREVGRGTGQRGGVHGRGGLCLAGDRQEAQGRLRPRRVAEHVVPDGPLREGVALREPEAGRAAVSDRRGRRVLHLHGRGVSEQQRDPLLRHVQPGRAPGVLRGALHPRGPVALPPLPAVAGPARRLCAVPQQGWCLQKDRRPLGSRGVCPVDPRGRLCQHGVHRAHRWGEEHPSSPVETDMLPLAEGRGCLHPVPQSKLLHSIPCDVCPEGWPVHENGAREGTDWRWHHLLRQKDRLLCPHASRLHPEASEYLRGCRNEKWRLSKRELGNGQVHIQGQEEGKKGESSGALRGPADRVRSLYSPAE,NHYQMRRKGRCHRGSAARHPSSPCSVKHSPTRETLTYAQAQRMVEIEIEGRLHRISIFDPLEIILEDDLTAQEMSECNSNKENSERPPVCLRTKRHKNNRVKKKNEALPSAHGTPASASALPEPKVRIVEYSPPSAPRRPPVYYKFIEKSAEELDNEVEYDMDEEDYAWLEIVNEKRKGDCVPAVSQSMFEFLMDRFEKESHCENQKQGEQQSLIDEDAVCCICMDGECQNSNVILFCDMCNLAVHQECYGVPYIPEGQWLCRHCLQSRARPADCVLCPNKGGAFKKTDDDRWGHVVCALWIPEVGFANTVFIEPIDGVRNIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCTRRPLNIYGDVEMKNGVCRKESSVKTVRSTSKVRKKAKKAKKALAEPCAVLPTVCAPYIPPQ