McDonnell Genome Institute

Washington University

CircRNA

chr22|46658186|46663172|+|GRAMD4|ENST00000361034.7

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.921

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

GDAAAGAGPR

Amino Acids from 5' Exons

RRSSGSCEKKPTRRCCGRSWTASGSGGWSWSRRCRRCRP,GGAPEAARRNQRGDAAAGAGPRAAAADGAGAEGAGGAEGQ,EELRKLREETNAEMLRQELDRERQRRMELEQKVQEVLKA

Amino Acids from 3' Exons

SAGARGCPRACRSGSTSGLGSTWRTSGSSPRRTLWRQRNPAPA,APEPGAVLAPAEVVLRAVWGVRGGLPVPARGEHCGDRGTPERPQ,RRSQGLSSRLQKWFYERFGEYVEDFRFQPEENTVETEEPLSAR