McDonnell Genome Institute

Washington University

CircRNA

chr22|46409754|46411759|-|CELSR1|ENST00000262738.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9574

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

2

Peptide

LLGGTSAMGGGVR

Amino Acids from 5' Exons

AALLGGTSAMGGGVRMEAPVSTGGICICVSVHSDSAGRTVSK,LRCSEELLRWEAVSEWRHLCQQVEYVSVVSTPIRREELA,CAARRNFCDGRRCQNGGTCVNRWNMYLCECPLRFGGKNCEQ

Amino Acids from 3' Exons

PNIGHLGLPHGPSGEKMAVVTVDDCDTTMAVRFGKDIGNYSCAAQGTQTGSK,PILATWACPMGRPGKRWPWQWMIVTQPWLCALERTSGTTAALPRALRPAPR,QYWPPGPAPWAVRGKDGRGDSGLHNHGCALWKGHRELQLRCPGHSDRLQE