McDonnell Genome Institute

Washington University

CircRNA

chr22|46346421|46350463|+|TRMU|ENST00000290846.8

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9662

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

GFSEIGLK

Amino Acids from 5' Exons

GQMPLPQVTMQELPWKMKKSLSRSTLRSPKGFSEIGLKLEM,GRCHCHRSLCKNFPGRRSLAEAREARRAFQKSVSK,ADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRN

Amino Acids from 3' Exons

RNSSRQLTALKTRPSFSARFPRMPGEPSSLWGDRKSLRKSLLRIDFIMCFRRK,GKTPPGSQLRPDLLSQPGFPGCPEENHLPSGGINERVCKENRCETSSCASEER,VKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKE