McDonnell Genome Institute

Washington University

CircRNA

chr22|41349119|41349301|+|ZC3H7B|ENST00000352645.4

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9001

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

10

Peptide

AQGLAAAAVLR

Amino Acids from 5' Exons

VPGAHRPLHLPQVLQDPPVPGALPVRRVPPGALRLPAGGQLPLRPQLHRAQGLAAAAVL,CLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYS,AWCTSSAPPPSSTPRSASSRSTSSSTCAAMRCATAACGRTAATSPTASSSSRSGCCSSTQ

Amino Acids from 3' Exons

VPGAHRPLHLPQVLQDPPVPGALPVRRVPPGALRLPAGGQLPLRPQLHRAQGLAAAAVL,CLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLREDSCHFAHSFIELKVWLLQQYS,AWCTSSAPPPSSTPRSASSRSTSSSTCAAMRCATAACGRTAATSPTASSSSRSGCCSSTQ