McDonnell Genome Institute

Washington University

CircRNA

chr22|40407016|40409525|+|SGSM3|ENST00000485962.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9279

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

LLFGESSASAR

Amino Acids from 5' Exons

VVRRRTQRRKSTITALLFGESSASARQCGHAGVCPHAHVDVELPPRGPGVGCGHHGSLGLLGEDDLEALKAKNIKQTELVADLREAILRVARHFQCTDPKNCSVVSRQLPGLLPNTALTPPTPLVGLCSLWQELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIIT,LFAAGPSGGSPPSLLCSSVRALRVPGSVGMRESVLTLMWTWSFLLGGLEWAVVTMVLWASGRMTWRHSRPRTSSRRNWWLTSGKPSCAWHATSSAQTPKTAAWVASSLGCYQTRPLLQPPWWACVHCGRSLQTIAWRATSGTTRTTWRAHAATGAEPRPCWTLSGTTTTSWASARTTSS,CSPQDPAEEVHHHCSALRELCECQAVWACGSLSSRSCGRGASSSGAWSGLWSPWFSGPPRGGPGGTQGQEHQADGTGGPPGSHPARGTPLPVHRPQKLQRGESPAPWAATKHGPNSSNPLGGPVFTVAGADSRLHGEPPAGPRELRGVLTQPPAPSQGPAGLAARRRRAGLPQERHHH

Amino Acids from 3' Exons

SPLLLCLQPLPGLGAPCEER,VLCCFAFSLSQDWELPAKRE,SSAALPSASPRTGSSLRRE