McDonnell Genome Institute

Washington University

CircRNA

chr22|40246014|40321229|+|TNRC6B|ENST00000301923.13

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9701

62

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

6

Peptide

AQTALHIEK

Amino Acids from 5' Exons

REGARKGRTVNGRQEKEERGKEKRSHSE,EKEQEREEQLMEDKKRKKEDKKKKEATQK,RRSKKGKNSWKTRKGRKRIKRKKKPLR

Amino Acids from 3' Exons

IDGSTLRTICMQHGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALH,LMGQPERSACSMAHCHSIIPRALPSDTAPNRRRPRPKLHCT,WVNLENDLHAAWPTADIPSESNPGHCPDPIQHQTGGGQGPNCTAH