McDonnell Genome Institute

Washington University

CircRNA

chr22|38742300|38752665|-|SUN2|ENST00000405018.5

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9369

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

VHIPPHHVPK

Amino Acids from 5' Exons

AEQRVMSRVHSLERRLEALAAEFSSNWQKEAMRLERLELRQGAPGQGGGGGLSHEDTLALLEGLVSRREAALKEDFRRETAARIQ,LSSVLCPGYTLWSGVWKLLLLNFPPTGRRRPCGWNVWSCGKGLLAREVVVAATRTPWRCWRGAAVKLPRRISAGKLLLAS,AACYVPGTLSGAASGSSCCIFLQLAEGGHAAGTSGAAARGSWPGRWWWPEPRGHPGAAGGASEPPSCPEGGFPQGNCCSHP

Amino Acids from 3' Exons

ILFRGRVHIPPHHVPKKPAPHALLPGRRQQQQRRELGGWESEHPVRQSSQ,FSSGEESTSHLIMSRRSQRLTRYSQGDDDGSSSSGGSSVAGSQSTLFKDSPL,SLQGKSPHPTSSCPEEASASRATPRVTMTAAAAAEGARWLGVRAPCLKTVLS