McDonnell Genome Institute

Washington University

CircRNA

chr22|38495795|38501280|-|DDX17|ENST00000216019.11

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9761

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

RNLVILGSVCVK

Amino Acids from 5' Exons

CLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLER,VFWLLPESLPSKYSRWPMTMANVLDRVLVFMEVLLKVPRFETWKE,SSSGSYQRACPASTAGGRLWQMFIEEYLYLWRCSRSPDSRLGK

Amino Acids from 3' Exons

IWSKRWWWPSPEEIWSWGAFAKKVGFEAPQVEKFLCGTSGSSKADT,FGARGGGGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTP,LEQEVVVAFPRRNLVILGSVCVKKSGIVSSPSLRKIFMWNIRKQGH