McDonnell Genome Institute

Washington University

CircRNA

chr22|37515972|37518108|-|CARD10|ENST00000251973.9

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9425

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

DLQLAGA

Amino Acids from 5' Exons

MRRGLRAPNSQRCDGCGKLARASCSGSSNCRPGAGCSRRSGQGWSSGCGTSSRLRSAVNGCGRTGRRAAWSCCGSRMRTTSPCAWHSSVRRRTRLYFAAVTCSW,GGAGPDPILDDRGATAAGSSQEPAAAGAATAGPGPGARGGAGRAGAAAAGPAAGSGALSTAAGGLGGGQPGAAAAQGELHDRHAPGTAQGEELGCTSQPPAAG,EEGPEGLTQFLMTEVRRLREARKSQLQREQQLQARGRVLEEERAGLEQRLRDQQQAQERCQRLREDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLA

Amino Acids from 3' Exons

GAWTSCAAVARGAMRPSWKPWSSTTPNTSRCSRARNPPSAAPSS,APDGHLALPWQEGLGLPGSPGVLLPRTLHAAHGPGTRPALLHDP,RLMDILRCRGKRGYEAFLEALEFYYPEHFTLLTGQEPAQRCSMIL