McDonnell Genome Institute

Washington University

CircRNA

chr22|36303994|36312222|-|MYH9|ENST00000216181.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9972

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

18

Peptide

LLQGLPGQEAGPPGILALLDEECWFPK

Amino Acids from 5' Exons

IKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKITDVIIGFQACCRGYLAR,KPWSSTAICTALARAKSSSVPVCWPTWRRSETRSPTSSGSRPAAGATWPG,KSPGARQQSVPHWPEQSLLPCRCAGPPGGGARPEDHRRHHRVPGLLQGLPGQE

Amino Acids from 3' Exons

AGPPGILALLDEECWFPKATDKSFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGK,QAPRAFWPCWTRSAGSPKPPTRASWRRCRSRAPTPSSRSPSSRTKLISALSTMPA,RPPGHSGPAGRGVLVPQSHRQELRGEGDAGAGHPPQVPEAQAAEGQSFLHYPLCRQ