McDonnell Genome Institute

Washington University

CircRNA

chr22|36291985|36306607|-|MYH9|ENST00000216181.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9278

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

9

Peptide

FDQWTASSAWTR

Amino Acids from 5' Exons

VADMKKKMEDSVGCLETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLEKKQKKFDQ,WPTKRRWRTVWGAWKLLRRRGSSRRTWRAASGTRRRWPPTTSWRRPRRGCSRSWTTCWWTWTTSARARATWRRSRRSLT,GRHEKEDGGQCGVPGNCGGEEEAPEGPGGPEPAARGEGGRLRQAGEDQDAAAAGAGRPAGGPGPPAPERVQPGEEAEEVP

Amino Acids from 3' Exons

WTASSAWTRWPACRRPHCPGPSRRGRACSALWGSFTRSSWPSWLRGTRTPTLSAASSPTTRR,GPHHRPGPGGRHVGDRTARGLQDAEGHVPHCGAALQGAAGQADGYAEEHEPQLCPLHHPQPREE,DRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMATLRNTNPNFVRCIIPNHEKK