McDonnell Genome Institute

Washington University

CircRNA

chr22|32229193|32235093|-|SLC5A4|ENST00000266086.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9395

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

13

Peptide

LDAFNEVGGYESFTEK

Amino Acids from 5' Exons

DCEACFRSCWPLSAPPPSSTAPAPSSPLTSTPRCGSKRRRKSSLD,TARPDAFGHAGLSHELPDLHLQQRQHPLHHPLHQDAEASVGERAPDSWT,LRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEKELLIAG

Amino Acids from 3' Exons

HLTKLEVMRALPRSTMPPHPSRGTTQSVPVATHLGRTPSTSSEMLLGTFHGQELYLECPLQLCGTGAQI,IRSWRLELYREVRECHPIRSRGGQLDNQCQLLHTSGGLLPHLPRCCDWGHSMARNYIWNAHYSFVVLVHKS,FNEVGGYESFTEKYVNATPSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQ