McDonnell Genome Institute

Washington University

CircRNA

chr22|31758545|31819225|+|DEPDC5|ENST00000382111.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9539

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

WMHTFPVDDELVVNPK

Amino Acids from 5' Exons

MMSLTPKCSLTSSLETLRLHTPTMNT,ASCEPQSVPSHQAWRHCRDCTPQRIQ,DELVVNPKVFPHIKLGDIVEIAHPNDEY

Amino Acids from 3' Exons

MSWRTWSHHSETPVHQGGFTLAVQNPCCMFDLVDTRPREHLTPSLPLGCPSLRPTEGAGCTLFLW,CPGEHDGATTARLQCTREVSRWQCRIHAACSTWWIHAPESTDPLRSLSDAHEAYVQQKALDAHFSC,VLENMMEPPQRDSSAPGRFHVGSAESMLHVRPGGYTPQRALINPFAPSRMPMKLTSNRRRWMHTFPV