McDonnell Genome Institute

Washington University

CircRNA

chr22|31454143|31471917|-|EIF4ENIF1|ENST00000330125.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9345

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

7

Peptide

VSEELLDIK

Amino Acids from 5' Exons

HIQGLCFQWRRKQVRARLTSKRIQLPSWQNTKRPVPPTIDNRKTETLRSTSAQRQVGLCLLSPKS,TFRGCAFSGGGRSRSEGLEGPASEEFNSLHGRTPRRDLECRNQQSTTEERRRHDCVQQASEHNEGKWDFAFSAQSQ,HSGVVLSVEEVEAGLKGLKVDQQVKNSTPFMAEHLEETLSAVTNNRQLKKDGDMTAFNKLVSTMKASGTLPSQPKVS

Amino Acids from 3' Exons

EELLDIKELPHSKQRPSCLSEKYD,KNSWIKNSPIPNRGLHAFLKNMT,RTLGYKRTPPFQTEAFMPFKIQ