McDonnell Genome Institute

Washington University

CircRNA

chr22|31441773|31443094|-|EIF4ENIF1|ENST00000330125.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9555

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

12

Peptide

LLSPSFTPTSVIR

Amino Acids from 5' Exons

KTSCHPALYPVPIETLLPLQIPNCQHYRGLRVPPHCPRPTVTPKNKIIDLKQLGEKHPPWHPQFLQHLFSALSTKFPLSPMSLWLGLLTSFTQGWYRGCWPREYIHSIFQVCSKL,KPPVIQLCTQCRSRLFSHYKFQTVSITEVFVFHPTVPGQPLHQRTRLSTSNWEKNTHLGIPSSYNTFSPPCPPSSPCPPCPYGACSPASPRVGTEDAGPGSTSTASSKFAPN,NLLSSSSVPSADRDSSPTTNSKLSALQRSSCSTPLSQANRYTKEQDYRPKATGRKTPTLASPVPTTPFLRPVHQVPLVPHVPMVRPAHQLHPGLVQRMLAQGVHPQHLPSLLQT

Amino Acids from 3' Exons

LSPSFTPTSVIRKMYESKEKSKEEPASGKAALGDSKEDTQKASE,FLLPLPLPQFVRCTRAKRKARRSQHLEKQLLVTVKRILRRPVK,FSFLYPYLSDSDVREQREKQGGASIWKSSSWQRGYSEGQ