McDonnell Genome Institute

Washington University

CircRNA

chr22|31403028|31423410|+|DRG1|ENST00000331457.8

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9137

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

ETGFDVAK

Amino Acids from 5' Exons

VLMWPRQVMLELDLLVFHLWGSQHCLVTWQGYILRWQPMNSLLPLCLVSSDTKVPRS,FCGQDRCSNWICWFSICGEVNTAPGRGIFGGSLIHYSDHCAWCHQIQRCQDP,FDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQ

Amino Acids from 3' Exons

CPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGN,APRVSWMLKLRAFWLNTRFIMPMLYVVMLQLMTSLMWWKET,PPEAGCNCEEHSGIQDSCRCDSTCYSPHCGGRKQ