McDonnell Genome Institute

Washington University

CircRNA

chr22|31182968|31187270|+|RNF185|ENST00000468921.5

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.976

44

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

TPVQGGPVGAAMALAR

Amino Acids from 5' Exons

VGVRHNLSSLQPPPPGFKRFSCLSFSSSWDY,LECDDTISVHCNLRLPGSSDSHASASQVAGIT,WSAMTQSQFTATSASRVQAILMPQLLKLGLQ

Amino Acids from 3' Exons

DFPGESLHSELRQPRMASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLF,ISLGKVFTQSFADSQGWQARGPRPLHLLRTPVQGGPVGAAMALARAEGRTALSSATSAWTQPRMPSSACVATSS,FPWGKSSLRASLTAKDGKQGALGLCISELQCRGAQWEQQWRWRERRAGQHFRVQHLLGHSQGCRHQPVWPPLL