McDonnell Genome Institute

Washington University

CircRNA

chr22|29299194|29299851|+|EWSR1|ENST00000360091.3

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9977

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

10

Peptide

GGRGGPGKMDNSIGDFCCDVIVCR

Amino Acids from 5' Exons

FNWFLLCNCMQGLWKPELRLENRVQP,SIGDFCCDVIVCRGCGNQNFAWRTECNQ,QLVISAVMLYAGVVETRTSPGEQSATS

Amino Acids from 3' Exons

VVIVAEVALVACGEEEVASWIVVVPVECSEVAVVETEVASVVAGAWTEVALVEEDEVALGGPLDLWNRWEEEEEDVEDLEKWI,WSWQRWPWWHAGRKRWPHGSWWSRWNVQRWPWWRQRWLPWWPGHGPRWLWWRKTRWPWGAPWTFDGTDGRKKRRTWRTWKNG,GDRGRGGPGGMRGGRGGLMDRGGPGGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPPGPLMEQMGGRRGGRGGPGKMD