McDonnell Genome Institute

Washington University

CircRNA

chr22|28699837|28725124|-|CHEK2|ENST00000328354.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9675

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

5

Peptide

LYFYQMLLAVQEVGPK

Amino Acids from 5' Exons

DGRGRAVQSGGETPERSYLQALFLPDALGCA,MEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQ,WKGESCLTKWWGINAKKLPASSIFTRCSWLC

Amino Acids from 3' Exons

EVGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLSRNK,KWVLKTLTLHTKITVAMEPLIQSLGKENAVLITILKLHCHAEIK,SGSKLLHCIHRRSQWQWNLCKYRACRERKTPSFEQFNCTVTKQK