McDonnell Genome Institute

Washington University

CircRNA

chr22|28694031|28695873|-|CHEK2|ENST00000328354.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9716

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

8

Peptide

HPWLQITDFGHSK

Amino Acids from 5' Exons

LWTLSRSCWWIQRHVLRQKKPDTRGF,SGPCQEVVGSGSKGTFYDRRSLKTPVAS,LDLVKKLLVVDPKARFTTEEALRHPWLQ

Amino Acids from 3' Exons

ITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFI,LLILGTPRFWERPLSEPYVEPPPTWRLKFLFLLGLLGITVLWTAGVELFFLS,YFWALQDFGRDLSHENLMWNPHLLGASSCFCWDCWVPCCGLLEFRSYSFYL