top of page

McDonnell Genome Institute

Washington University

CircRNA

chr22|26494138|26506928|-|TFIP11|ENST00000405938.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9737

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

6

Peptide

AVSSNVGPVTTLR

Amino Acids from 5' Exons

VLCSWLSNSPNYEEITKWYLGWKSMFSDQVLAHPSVKDKFNEALDIMNRAVSSNV,CCALGSVTAQIMRRSPSGTWVGSRCSQTKCWHIHLSRTNLMRHLISTGRCPPTL,AVLLAQQPKLGDHQVVPGLEVDVLRPSAGTSICQGQIGTYHEPGGVLQR

Amino Acids from 3' Exons

GPLLCASQLHQRRAQERGSGGGRVGRFRRETCAGRLSGFWTKEAKN,ARDYSAPVNFISAGLKKGAAEEAELEDSDDEEKPVKQDDFPKDFGPRKLKT,PVTTLRQSTSSAQGSRKGQRRRQSWKILMTKRNLLSRTTFLRILDQGSK

bottom of page