McDonnell Genome Institute

Washington University

CircRNA

chr22|25170819|25177522|+|KIAA1671|ENST00000494730.2

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9858

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

VDDFSFIDVSQWPGAFLLK

Amino Acids from 5' Exons

DQLKQCFSRQPTEPKDTDTLVHEAGSQYGTWTEQCQSGE,TSSSVSPGSPLNPRTLTPSCTKPAASMGRGQSSARVGR,PAEAVFLPAAHTQGHHPRARSRQPVWDVDRAVPEWGE

Amino Acids from 3' Exons

LGHVPRQCHIDKETAPQQPFVFSVLPNGAHLGRGPVLLQGPAEHQRGPLQHPGIHRWDGGAASTGRLPKESRLLLHCKSVARSISSMEIPASLCELPLQVDLCARDPWSGYGGHCLNGTHLCMYLGPAIHLLCVLGQMSSPLASASLSTCNQHHQLHSLKYNCMHSNNSKPLPARAGSLTTYPWEVTLRFIVASMKRLEFAQNDSAERSHGLAWYNSVPGIRGSDCLCSGSSRTESPLRHGHLSWRSQGTVPSTQLFQVPSTARMSAAPAQVKRSPALASSRPELILLSPGSPTSRGQAGLPFQPLKPRGDVIILLAQGYLPTFWGMEHLQNVKGTLSPGSKASHLHTWAWLPTFPQRRNTAALEKGLPLGLQRGFSFSIWPRSLAGTSRSGRRQRKTQVESLGNPIIPWPCPPPWVSSGFSVIYSVIHSTDMYDLAVCLTCQHHVTASTFLLERVVPSCPLTTISECPLAQAHVNNPRGKTACAFCKLANQSGHGVTLNAGVPKHRSNAYNYTAVYVCPPRFGSPVGILRFMYGANHDLGLLWGRFGGQMGRRRRSTKESSLCTRLRMQGWHHLPLQASPSVSVILSCSLGVKPGSVKWPEKQACLVQQALSDFRLSPSFTGPVQVSSQDTTVAGLGSSYDQLLPPPHWDFCYLPLLGNDSLKLACHHLRRPWVMEFLQSGPRRKKPTFHVRTACRKELLAVSRGQALSETRAFHTAQGVLSATVGRRHSVYLLFINRDTQAQRSEAHCPRSHNQDSNPAGFEPQLALHCCLPGEFARHFPSPYWGPPRWSVLPTLSLGGPSPTPHLSQLRVVFRDAKWTPDVAAPSLPTCTLDYVSNGGIPRRTSQPGDSVIQLTEGFSMLNPLFIQQTNINAPAVYSLLITCLCGGCHWEGKGICIMCLLGARKPGTVLGHSRFIVPPDFCHQPMGYVLWGNLGFGCVTIKMWKPWPRYHLNSLSSVNEAVYRQLCCGTLHWFPFFSSSSLLLPKQTSVLDSSALKTRVQLSKRSRRRAPISHSLRRSRFSESESRSPLEDETDNTWMFKDST,LATESPDSSATSTRKQPPSSRLSSLSSQTEPTSAGDQYDCSRDQRSTSVDHSSTDLESTDGMEGPPPPDACPEKRVDDFSFIDVSQWPGAFLLKWKFQPLSVNCHFRCRICVPGTLGVGTEGTVFEMGLTYACILDLPYTCCVSWGKCLHLSEPQLPYPLVTSIISSTASNTIACIQIKTDLSPYLLGKQGVPLTPGKSPGLLQARGWSLLRMILLNVLTKVLLGTTVSLVSGDPTVSVVALPGQKVPSGMGTFHGGPRGQSLALSSFRSQAQPGCQLPQHSRSNGLLLHLPDQNLSSFPLGAPPPGVRQVFLFNPNPGVMSLFSSRNNRATCPLSGGWNICKMKGPSLLAVKPPTYTLGHGYPHFPRGGTPLLKKGFLGFKEDSPSVYGQGLSLAPLDQGGDKERHKLSLDWGTPLYNHGHAHLPGCHQDLVRYIQLFTQQTCIEILLCALHASIMSLHHELSCNAKWFLLDVHYKQQSVSVDHWPRHMLITPEAKLPALFANQIRVAMELMLVSRSIGLTLTEIILRFMCDAHHDLGLLWGYGLCMVPTMIVSCGDGLEAKWGGGGGALRNPVSVPGGCKGGTIFPSKPAPLSVFCPALLESENLALLSGRRSKPASRCSRHFLISVFPPLSLVPCKSPHKIPLWLVWEVAMISSFHHPIGTFVTYHCWEMIHNPVITDLEGLGWNFSKVDLGGRNQHFMERELAGKSSWLAVVRLCLKQGLSTPEHREFSQPLEGGTLFISFLIGTPKLREVKLIAQGHITRIRTQQGLNPSSEHFTAVSRENSEPGTSHLLTGAHPDGLCSPPFHWGGPHQPPTCRSSECESSGMPENGLLMFSKLPPPFPPAPIMVMEEFHGERLNPGTLCEYSQKDLVRCIHYSFNKQTLIELLLCTDHCCRLHACVVDVTGREKAFVLCAYWVPGSQALYGTQGSLFHLTFVISLWGMFYGEIALGVRLLLKCGSPGLGTTIASHLSTKLCTANCVVVPSIDGSLDFFPLPPCCSQSKPQSSTQVPSRPGCSSAREAAAGPPSPTPSGAADLVSPRADHLWRMRLTTRGCSKTQR,WPLSPQIAVPHRQGNSPPAAVCLLCPPKRSPPRQGTSMTAPGTSGAPAWTTPALTWNPPMGWRGRLHRTPALKREMTSPSLMVSGQEHFFLNGNSSLSLIATSGVGSVCQGPLEWVRRALSLKWDSLMHVSWTCHTPAVCLGANVFTSLSLSFLIHLPASSAPQPQIQLHAFKLKLIALTCVSRESDHLPLGSHPEVYSCKHEEAGVCSEFCTFSLRSCLVQQCPWYQGIRLSLWLFQDRKSPQAWAPFMEVPGDSPHSALSGPKHSQDVSCPSIAGQTVSCSSIFQTRTYPPFPWEPHLQGSGRSSFSTLETQGCHYSPRVTIGLPAHFLGDGTSAKCERDPLSWQSLPPTHLGMATHISPEEEHRCFRKRASFRASKRILLQYMAKVSRWHLIRAETKKDTSVLIGEPHYITMAMPTSLGVIRILGDIFSYSLNRHVLRSCCVPYMPASCHCIMNFPARTLSGSFLMSIINNNQVLTTGPGTCPQRQNCLRFLQISKSEWPWSDSKCWCPEAVRLLKLYCGLCVMPTTIWVSCGDTEVYVWCQPFRSPVGTVWRPNGEAEAEHGIQSLYQAEDARVAPSSPPSQPLCQCDSVLLSWSLKTWLCVAGEASLPLGAAGTFFPSFPLFHWSRASLLTRYHCGWFGKLSAPSTTPLGLLLLTIVGKFIEISLSSLTKALGDGISPKWTAEETNISCKNVSLPERALGCEPWSGSVNKGFPHLSTGSSLSHCRKEALCLSPFYKGHPSSEKSSLPKVTPGFEPSRVTPALSTSLLSPGRILSQALPISLLGPTQMVCAPHPFTGGALTNPPPVAAPSVSLQGCLKMDSCLVSCPLPSHLHPRLCEWRNSTENVSTRGLCVNTVDRRILDVESIIHSTNKHLSSCCVLIIAVDYMLVWWMSLGGKRHLYYVPTGCQEARHCTRALKVHCSTLLSSAYGVCFMGKFRLWVLGYYNVEALAVPPKPLICQRSCVPPTVLWYPPLMVPLIFFLFLPAAPKANLSPRLKCPQDPGAAQQEKPPPGPHLPLPPAQPIVREQITFGGDQHVDVQRLN