McDonnell Genome Institute

Washington University

CircRNA

chr22|23779186|23781409|+|MMP11|ENST00000465385.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9575

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

VHLACVLSVHTPTK

Amino Acids from 5' Exons

DAHHLHAERRGPQPWHAALPSSPAPAPATQEAPRPASSLRPPRCGVPDPSDGLSARNRQKRFVLSGGRWEKTDLTYRGPGSRTLGCHLCVRGASCPHSCCLRHRPGIFVSNRPVCPLNPREVIYGQTPNPNLDTYTYGDPPSAEGQSLRHHAKSRSTCLRTGVQSLRQPLQETCEDQALGLHGEGRHSPILCVSLRWVSAMSLSNSTITTWASSRWRQWAGRGNSGHLTGPGRTLGRWGSGSHILRVGTQPEEWAGVTQHWSDWGLNFLGGGLGTNRGSRNQGVPTVSGTVRSRMGVSGPLVLVLSTEFRHLYLPKYEQTTYTCAHVARETSALKLRPRVHLACVLSVHTPTKHPGATPGASAIGGCPFPEAQAPPSPSRILRFPWQLVQEQVRQTMAEALKVWSDVTPLTFTEVHEGRADIMIDFA,TPTTSMPRGGGHSPGMQPCPVARHLPLPRRKPPGLPAASGLPAVACPTHLMGVPATDRRGSCFLAGAGRRRTSPTGRGLGAGHDATCVSVGKPAALTAAADTGQGRSSCLTDLCVHTPGRSSMGKPPETPTTHTHMETLPQQRGRASVIMQRVAAHACGRVFSHSGSLYKRPVRTRLWDSTVNEADTAPSSVSVGGCQPCHCPTLPSQLGLRAGGDSGKRGEAIVGISLGDLGGPWAGDGEAEAHTSCGWGPSLKNGLVSHSIGAETGVFRISVGAWEPTGAQGTKVSPQVALSGLGWGSRDPWSWFFPLNSDTCICLSMSKPHTHVPMWPGRPVRSGPEYTWPVSVFTHPPSIQGQLLVPQPSGAVPSLRPRPLHLPPGSFGSHGSWCRSRCGRRWQRPRYGAMRHSPLLRCTRAVLTSSTSP,RPPPPCREEGATALACSPAQPGTCPCHAGSPPACQQPQASPLWRARPIWAECPQPTEEVRAFWRALGEDGPHLQVGAWEQDTRMPPVCPWVSQLPSQLLLETQARVDLRVQTCVSTEPQGGHLWANPLKPQLRHIHIWRPSLSRGAEPPSSCKESQHMPADGCSVTQAAFTRDLGPGSGTPRMRQTQPHPLCQSEVGVSHVIVQLYHHNLGFEQVETVVSGERQWASHWVTWEDPGQVMGKLRLTHPAGGDPARMGWCHTALELRLGSLEFPRWGPGNQQGLKEPRCPHSKWHCQVDGGLGTPGPGSFHIQTLVFAVANHIHMCPCGQGDQCAEAEAQSTPGLCPECSHTHQASRGNSWCLSHRGLSLPGPGPSISLQDPSVPMAVGAGAGAADDGRGPKGMERCDATHLYGARGPCHHDRLRQ

Amino Acids from 3' Exons

PDAPPDACEASFDAVSTIRGELFFFKAGFVWRLRGGQLQPGYPALASRHWQGLPSPVDAAFEDAQGHIWFFQ,QTPRQMPVRPPLTRSPPSEASSFSSKRALCGASVGASCSPATQHWPLATGRDCPALWTLPSRMPRATFGSSK,RRPARCLGLLRGLHHPRRALFLQSGLCVAPPWGPAAARLPSIGLSPLAGTAQPCGRCLRGCPGPHLVLP