McDonnell Genome Institute

Washington University

CircRNA

chr22|20779296|20780201|+|SERPIND1|ENST00000215727.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9736

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

LHLLQSFSSAK

Amino Acids from 5' Exons

LLRQNETLIKRTSHFPHHNICVGWEQRPAGSARERRGNCSVCRSPVGAVKQKPEHASSPCRLPQGKHRHQRLDSRGGGGRRLSGPGEDIQRRRLHRHRRQSVSFPDRLCECWEHPPAFSWQEPDPASHPQRQVRFQPLPSAERPGQHFRHLHSTRWHFYCDGYDFLRSEGRDPTSALDFAFRLCCQQQVNHDHSSLPADSSPLQEEFWVHTAVSQPLYPEAVSNPALQNSKRVLLCGPDSLLRPCLHIKNQQPHHEAHQGPHKRCSGEYRPCYPDDDSQLHLLQ,FSSAKMKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFHKENTVTNDWIPEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHGKSRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFK,LAPPKNTHTHFSFSSSHLRGVGAKARWISRKEGKLLSLQIPSGSSITKTACLFSLPTSTRKTPSPTTGFQRGRRTTTIWTWRRYSVKTTTTSTSSTVCQFPRQTLMVLGTSSSFFMARAGSSVLTSSTPSSLSTSTECKTRSTLSITSSHPLAFLLRWVFPVRERPMNKCTRFCILKTLLMPAASMKSRPFIISSVSLIASSGGILGTHCGQSMTFISRSSFQSCLTSKLKESITLLRPRLTSQTLPSYQKPTTTSSSPRASKMLWRITLLPRFSTASTSK

Amino Acids from 3' Exons

LLRQNETLIKRTSHFPHHNICVGWEQRPAGSARERRGNCSVCRSPVGAVKQKPEHASSPCRLPQGKHRHQRLDSRGGGGRRLSGPGEDIQRRRLHRHRRQSVSFPDRLCECWEHPPAFSWQEPDPASHPQRQVRFQPLPSAERPGQHFRHLHSTRWHFYCDGYDFLRSEGRDPTSALDFAFRLCCQQQVNHDHSSLPADSSPLQEEFWVHTAVSQPLYPEAVSNPALQNSKRVLLCGPDSLLRPCLHIKNQQPHHEAHQGPHKRCSGEYRPCYPDDDSQLHLLQ,FSSAKMKHSLNALLIFLIITSAWGGSKGPLDQLEKGGETAQSADPQWEQLNNKNLSMPLLPADFHKENTVTNDWIPEGEEDDDYLDLEKIFSEDDDYIDIVDSLSVSPTDSDVSAGNILQLFHGKSRIQRLNILNAKFAFNLYRVLKDQVNTFDNIFIAPVGISTAMGMISLGLKGETHEQVHSILHFKDFVNASSKYEITTIHNLFRKLTHRLFRRNFGYTLRSVNDLYIQKQFPILLDFKTKVREYYFAEAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFK,LAPPKNTHTHFSFSSSHLRGVGAKARWISRKEGKLLSLQIPSGSSITKTACLFSLPTSTRKTPSPTTGFQRGRRTTTIWTWRRYSVKTTTTSTSSTVCQFPRQTLMVLGTSSSFFMARAGSSVLTSSTPSSLSTSTECKTRSTLSITSSHPLAFLLRWVFPVRERPMNKCTRFCILKTLLMPAASMKSRPFIISSVSLIASSGGILGTHCGQSMTFISRSSFQSCLTSKLKESITLLRPRLTSQTLPSYQKPTTTSSSPRASKMLWRITLLPRFSTASTSK