McDonnell Genome Institute

Washington University

CircRNA

chr22|20729312|20734553|-|PI4KA|ENST00000255882.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9212

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

16

Peptide

AAACQFMREMAGAWHMTVEQK

Amino Acids from 5' Exons

ATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPYLAVQLPA,PLRSSVSSHGTTRCQPRNWNTRPERTAWPTGDLSTSAVRSSGRTTTSPGASLPTPCSCLP,HDRASHHMVQPAVSPGTGTRPGRREQRGQLEIVHQPEEAVEGQREPRLEHLSLPSRAAACQ

Amino Acids from 3' Exons

FMREMAGAWHMTVEQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWID,SCGRWQGPGTRWSRNLACFLLRRKQTPWLPRKQVNPNPVPPKPPTTSGS,HAGDGRGLAHDGGAEIWPVFCDKGSRPPGCLGSKSTQTLSPRSDPPLHLDR