McDonnell Genome Institute

Washington University

CircRNA

chr22|19963565|19964299|+|COMT|ENST00000207636.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9511

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

13

Peptide

LEGPVPAGHASLGGK

Amino Acids from 5' Exons

ARSWTPFRSTSPPCCWSWGPTVATQLCAWPACCHQGRGSSPSRSTPTVPPSPSGWWISLART,QDRGRRDSGAPALRAAGAGGLLWLLSCAHGPPAVTRGEAHHHRDQPRLCRHHPADGGFRWREGQ,KIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDK

Amino Acids from 3' Exons

VCRDGLLSVRTWALTGAVPGHPCGWSVPGHHPPAEEEVCGHTGHGLPRPLEGPVPAGHASLG,CVGMASCLGRGHQALFQVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLE,VGWPPVCEDVGTDRRCSRSPLWLERPRTSSPSRRSMMWTHWTWSSSTTGRTGTCRTRFSW