McDonnell Genome Institute

Washington University

CircRNA

chr22|18121478|18127034|+|PEX26|ENST00000474897.5

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

13

Peptide

TIQFVDWCPTGFKR

Amino Acids from 5' Exons

RECISVHVGQAGVQIGNACWELFCLEHGIQADGTFDAQASKINDDDSFTTFFSETGNGKHVPRAVMIDLEPTVV,GNAYQSTWAKREFRLAMPAGSSSAWNTASRQTALLMLKLARSTMMTPSPPFSARLAMGSMCPGPSIWSLLW,GMHISPRGPSGSSDWQCLLGALLPGTRHPGRRHFCSSQDQRLLHHLFQRDWQWEACAPGRHDRSGAYCS

Amino Acids from 3' Exons

TDACSGLQGFLIFHSFGGGTGSGFTSLLMERLSLDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISAEKAYHEQLSVAEITSSCFEPNSQMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIAAIKTKRTIQFVDWCPTGFK,QMLALACRASFSTVLVGALAPASLLCWNASPWIMARNPSWSLPSTQPPRSLLQWWSPTTPSPPTPHWNIQIVLSWWTTKPSMTSAAGTLTLSALPIPTSTASSVRLCPQSLLLSALTGPSMWTSLSSRPTWCPTPASTSRWSPTRPSSLPRKPITNSSLWPRPAPALSPTARWSATRDMASTWPAACSTGATWCPRMMSLLLPSRPRGPSSLTGVPQAS,RCLLWPAGLPDFPQFWWGHWLRLHFSADGTPLPGLWQEIQAGVCHLPSPPGLYCSGGALQLHPDHPHHTGTFRLCFHGGQRSHLHLPQEPHAPYLYQPQPPHQSDCVLNHCFSPLRGPQCGPHVPDQPGALPPHPLPAGHLRAHHLCRESLSRTALCGRDNQLLLAQQPDGEVRPETWQVHGLLHALPGRRGAQGCECRYCCHQDQEDHPVCRLVSHRLQ